PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30147.m014309
Common NameRCOM_1497420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family ARR-B
Protein Properties Length: 754aa    MW: 81116.6 Da    PI: 6.4558
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30147.m014309genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.68.6e-26207260155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    k++++Wt+ LH+rF++a++++ G +kA+Pk+ile+m+v+gLt+e+v+SHLQkYRl
  30147.m014309 207 KAKVVWTNSLHNRFLQAINHI-GLDKAVPKRILEFMNVPGLTRENVASHLQKYRL 260
                    6799*****************.********************************7 PP

2Response_reg776.5e-26231311109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    +livdD+   + ++ ++l+   + +v +++++ +al  l+ +d  +Dl+++D+ mpgm+G++l k+i ee  k+p++++++ g+ + +le l+ Ga
  30147.m014309  23 ILIVDDDAPTLGIVSSMLKTCSL-QVVTVKNPLDALSSLQSSDgaFDLVITDLHMPGMNGIQLQKQIDEEF-KIPVVIMSSDGKRSAILESLESGA 116
                    8**********************.9999***************************************9999.9*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                      + +Kp++ ++l +
  30147.m014309 117 VYYMVKPVNLRDLKN 131
                    **********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004481.2E-2521133IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23004.6E-3421169No hitNo description
SuperFamilySSF521721.05E-2922138IPR011006CheY-like superfamily
PROSITE profilePS5011038.09122137IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.8E-2223131IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.84E-2624137No hitNo description
PROSITE profilePS5129411.138204263IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-26205264IPR009057Homeodomain-like
SuperFamilySSF466892.15E-19205264IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-26207261IPR006447Myb domain, plants
PfamPF002497.1E-6210259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MGRGRVASTH SHNKNSSLLT VQILIVDDDA PTLGIVSSML KTCSLQVVTV KNPLDALSSL  60
QSSDGAFDLV ITDLHMPGMN GIQLQKQIDE EFKIPVVIMS SDGKRSAILE SLESGAVYYM  120
VKPVNLRDLK NVWQYAMASK KGKEVVVAEE PENNDGEASA STEKDSCEDN NSASVSANEE  180
SNNKKKKGKK RARDHDQGED APSAPKKAKV VWTNSLHNRF LQAINHIGLD KAVPKRILEF  240
MNVPGLTREN VASHLQKYRL FLKKVAERGL WSSQALSERA MRSSFASGYS SMFLKNAHQD  300
YSQLPGLQQL RPTFQPGYGG NISGLGTSKF GFSGCHSQEA SSSNSLPQIR FGQSSLFGSN  360
LSSFQQRSMF GNTSPLYSSN DTRPGLSTTN TAGLNMSPNG ATTFGLMNDA ANGLSNCTSP  420
KQMHQQQNQS RSTPLPFFQF GSGLSSSNYA SSIGGTGTSS NSYLSSLNPN GNYAGIRLTN  480
EGELIGSGQV RFNGNELTST GFNGGYDSSL LNWNISNDNL NSNAQTGGDI FGYLPPQGGS  540
SSATFGNYLA QGASSSTGFG TANPFSSILG AFNQENTSAL SPLSQQHINA SLGNAEEDND  600
FAFNLLNDAS IFDNNFNNQQ ELGEGDLSEL LFGSTNNITP SQQQSAEAVF NANFPISPYH  660
AGLNSGISEL LNAEFSSSCT ISDKTPWNEQ SSGQACSGKG RNKEPPWWQR QLSGRKLLSK  720
LGAGKLGERI SWTSYLEMSP TDVCMIHGQP EKDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-23203266164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015577595.10.0PREDICTED: putative two-component response regulator ARR13
TrEMBLB9R9G80.0B9R9G8_RICCO; Two-component system sensor histidine kinase/response regulator, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101422534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07210.15e-63response regulator 21